PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 234aa    MW: 27089.3 Da    PI: 7.5407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00071genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-172168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEde+lv+ +k+ G g+W++ +++ g+ R++k+c++rw +yl
       AA26G00071 21 RGPWTVEEDEILVKFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 68
                     89******************************99************97 PP

2Myb_DNA-binding49.51e-1575119248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g  T +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       AA26G00071  75 GGITSDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 119
                      56699****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-221271IPR009057Homeodomain-like
PROSITE profilePS5129417.1391668IPR017930Myb domain
SuperFamilySSF466891.47E-2917115IPR009057Homeodomain-like
SMARTSM007175.9E-142070IPR001005SANT/Myb domain
PfamPF002492.9E-152168IPR001005SANT/Myb domain
CDDcd001673.53E-112368No hitNo description
PROSITE profilePS5129424.08769123IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2472123IPR009057Homeodomain-like
SMARTSM007171.1E-1473121IPR001005SANT/Myb domain
PfamPF002493.5E-1476119IPR001005SANT/Myb domain
CDDcd001676.14E-1178119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MRRNDEGKKT TPCCSRMGMK RGPWTVEEDE ILVKFIKKEG EGRWRSLPKR AGLLRCGKSC  60
RLRWMNYLRP SVKRGGITSD EEDLILRLHR LLGNRWSLIA GRIPGRTDNE IKNYWNTHLR  120
KKLLRQGIDP TTHKPLETTN TIEEVSNGQN SQHQHTKDNK ISTINNVFAN EEEQEQDDDV  180
FGFCYDETFS SFLNSFINDD DPFGNNVIAS SSKDYEQEDP MLVTSSSFGH DHRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-27211234105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010500684.11e-113PREDICTED: transcription repressor MYB5 isoform X1
SwissprotQ388501e-111MYB5_ARATH; Transcription repressor MYB5
TrEMBLD7L1F41e-112D7L1F4_ARALL; Putative uncharacterized protein
STRINGscaffold_301556.11e-112(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-112myb domain protein 5